Protein Info for ABID97_RS29270 in Variovorax sp. OAS795

Annotation: cytochrome b561 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 60% identity to aaa:Acav_4657)

MetaCyc: 55% identical to L-ascorbate oxidoreductase (Cupriavidus necator H16)
RXN-21402

Predicted SEED Role

"FIG01024744: hypothetical protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>ABID97_RS29270 cytochrome b561 domain-containing protein (Variovorax sp. OAS795)
MERTLMAAAAHAALAQPWSWLLAPLSGADEHHIADWTAWHARLMVLGWGILLPLGALAAR
FFKIVPGQDWPAQLDNKAWWHAHRAMQYAGVLAMSAGLWLAWGTGGVRGAAAQLHAWLGW
GLCIAGWAQVAGGLLRGGKGGPTDVRLRGDHYDMTRWRVGFERVHKSLGWLAIGVAAMTI
VLGLAIADAPRWMAVVLVIWWSAFAAAFALLQRRGRCIDTYQAIWGPDAAHPGNRQPVVG
WGVRRYTAAAWRARSGPP