Protein Info for ABID97_RS29120 in Variovorax sp. OAS795

Annotation: LysR substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00126: HTH_1" amino acids 7 to 65 (59 residues), 82.6 bits, see alignment E=1.5e-27 PF03466: LysR_substrate" amino acids 90 to 296 (207 residues), 103.8 bits, see alignment E=8.7e-34

Best Hits

Swiss-Prot: 46% identical to OPRR_PSEAE: Putative transcriptional regulator (PA2220) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 49% identity to smt:Smal_3395)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>ABID97_RS29120 LysR substrate-binding domain-containing protein (Variovorax sp. OAS795)
MKLNQLDGLMAFWKVAEHGGFTAAAADLAVSPSALSQAIRQLEARLGVRLLNRTTRSVSL
TEAGEAYLARVGPALGQVIEAGDELHVLQGRPSGTLRLNAARVSTALVLRPLLDGFLRAN
PNVHLELTNDEGFVDIVDKGFDAGIRFGESIHRDMVAVPIGGPVAVAVVASPEYLKRVPA
PRHPDELVRHNCIRFRFAATGAIYKWEFEVDGRLTEYDIAGNLTLSDTMFGLDAALEGVG
LAYTFEQLARPHIRAKRLKRVLTAFSPTFPGFHLYYPSRHDQPSKLKALVEYVGRHRP