Protein Info for ABID97_RS28990 in Variovorax sp. OAS795

Annotation: aspartate 1-decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR00223: aspartate 1-decarboxylase" amino acids 1 to 125 (125 residues), 170.6 bits, see alignment E=6.6e-55 PF02261: Asp_decarbox" amino acids 1 to 114 (114 residues), 160 bits, see alignment E=9.7e-52

Best Hits

Swiss-Prot: 83% identical to PAND_RHOFT: Aspartate 1-decarboxylase (panD) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K01579, aspartate 1-decarboxylase [EC: 4.1.1.11] (inferred from 93% identity to vap:Vapar_6002)

MetaCyc: 54% identical to aspartate 1-decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate 1-decarboxylase (EC 4.1.1.11)" in subsystem Coenzyme A Biosynthesis (EC 4.1.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>ABID97_RS28990 aspartate 1-decarboxylase (Variovorax sp. OAS795)
MFRTLLKSKIHRVAVTDCELHYEGSCAIDEDLLDAANLSENEQVHIWNINNGERFVTYAI
RGERGTGIISVNGSAARRASVGDLIIIAAFGLVPEDQVAGYKPRLVFVDGANRIKEERGH
VPVQAASGEAALA