Protein Info for ABID97_RS28925 in Variovorax sp. OAS795

Annotation: ParB/RepB/Spo0J family partition protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02195: ParBc" amino acids 98 to 192 (95 residues), 49.5 bits, see alignment E=4e-17 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 99 to 270 (172 residues), 109.3 bits, see alignment E=9.9e-36 PF18090: SoPB_HTH" amino acids 199 to 269 (71 residues), 37.7 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 92% identity to vap:Vapar_6109)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>ABID97_RS28925 ParB/RepB/Spo0J family partition protein (Variovorax sp. OAS795)
MASTRKRLEALTAGLMLPEAARDPVAAEPAPATPAAVPPSAVNAMETRFPPAVGGSLAPR
TGPGQMMAFRGQIQQVEGEMAALREKLAQYEGSLPTRKMDPKTIRPSRWANRHDASFSSS
AFAGLKADIEHAGGNVQPILVRAVKEEPGQYEIVFGHRRHRAAMELGIPVLASIWVDELG
DAALFAAMDRENRERADLSNYEQGLMYQRALEEQLFPTQRQLAEALGVSHTWVRKALMVA
QLPPAVVECFRSPLEISFRHAEQINAAMEKDRRGVLKRVERLRGHSLAPAMVVARLLDAK
PGFERSEKLDIVSGGQKLGTLVRAKSGEITIVLSPEAATDASPEALEAGIAEALRKARTL