Protein Info for ABID97_RS28375 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details amino acids 295 to 320 (26 residues), see Phobius details PF02653: BPD_transp_2" amino acids 44 to 309 (266 residues), 100.8 bits, see alignment E=3.8e-33

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 98% identity to vap:Vapar_4297)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>ABID97_RS28375 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MNAVSAPMTVTAQPRARPWMQLRGELVLMLVGLLAFVLFPQDLGLLTNMATMSIFALSLS
LVLGQAGIATLGQAALYGSGAYVAGWTALYLTADPIVGLLLGGLGGGVIALLSGAVMLRS
TKLTLVMLTIAVAQLLLELANWARWLTGGDDGLAGFNIGPLLGIWEFNFLSYTGYFYALG
ALVLVYFLLRNLVESPFGLTARAIRQDPGRVQALGGRVYLHLLAVYTAGGIVAGLAGALT
AQTSKVANLFMLDFTTSAGVVVMIVLGGTRRLSGAVLGTVAYMTIHHISSTMNPYHWLFF
IGSMLIVVLIVLPEGLIGLVDRTVMYTKRPGSGVAR