Protein Info for ABID97_RS28155 in Variovorax sp. OAS795

Annotation: YihY/virulence factor BrkB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 30 to 54 (25 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 141 to 167 (27 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 18 to 274 (257 residues), 86.2 bits, see alignment E=1.7e-28 PF03631: Virul_fac_BrkB" amino acids 23 to 278 (256 residues), 177.6 bits, see alignment E=1.9e-56

Best Hits

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>ABID97_RS28155 YihY/virulence factor BrkB family protein (Variovorax sp. OAS795)
MNKLKHLLRLCKEAAMAWVDDYAPSMGAAISYYTMFSLAPLLVIVIALAGALFGAEAVQG
QIAAQLTGLIGQEGAEAVQALIKSANEPSRGLIAGGISAVVLVVGATTVFAELQSALDRI
WHVPERAKPSGVWGILRARVLSFGLILGLAFLLMVSLVVSAMLAALGNWSVGFFPGWELV
LQIVNAVLTLCILTVLFAMIYKLMPSAPIAWPDVWIGAAVTAVLFEVGKVLIGLYLGKSS
VTESFAAAGSLVVLLAWVYYAAQIFLLGAEFTKVYANAHGSVAAGKATAATELAARQSEQ
GTDSSAVRAHELEDDTETLEKVEETRRKLEDRTRKATAKLLQQAVGLFVISVATRVVARK
HRQARRDAARVRGNKAVR