Protein Info for ABID97_RS28130 in Variovorax sp. OAS795

Annotation: tannase/feruloyl esterase family alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF07519: Tannase" amino acids 12 to 449 (438 residues), 321.4 bits, see alignment E=1.8e-99 PF19878: DUF6351" amino acids 27 to 146 (120 residues), 22.7 bits, see alignment E=5.5e-09 PF00326: Peptidase_S9" amino acids 101 to 158 (58 residues), 25 bits, see alignment 1.8e-09

Best Hits

KEGG orthology group: K09252, feruloyl esterase [EC: 3.1.1.73] (inferred from 90% identity to vap:Vapar_6149)

Predicted SEED Role

"Chlorogenate esterase" in subsystem Phenylpropanoid compound degradation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.73

Use Curated BLAST to search for 3.1.1.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>ABID97_RS28130 tannase/feruloyl esterase family alpha/beta hydrolase (Variovorax sp. OAS795)
MSAATADVPVYCKVTGTISPSLNFQISLPEAWNGKLYYQGGGGYNGAITPPSAEALRQGY
AVAASDSGHQDNALSANFALTDTFAAQLFGSLSVPTVMSTATETLAAAYGAPPAKSYFEG
CSNGGREALMAVQRSPNLFDGVIARAPAYNWVGFMGAFNRNSKALAAPGGAFSAAKTALL
GKHVRDACDGLDGVVDGVVSNQAACTPALVNVAALRCAGGTDGGDSCLSDAQLGVVASWT
TEATFTGSTTFRNAGWNLTGNEDDPGAWRTWLTGDGDVTMALQFLFQDTTVKNYLARDRT
ASSLAYTPWDQNQNALYAMAALNDATNTDIRPFLNSGGKLILWHGGNDAALSARSTVEYY
GNMRSAVGAAAADASTRFYIAPGVNHCAGGPGADTADLLTALDQWVTKSKAPATLVAQKR
DGDGTVALSRPLCQYPQYPRYTGPANDAAAAKLAANYACSS