Protein Info for ABID97_RS28065 in Variovorax sp. OAS795

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14691: Fer4_20
  • amino acids 17 to 99 (83 residues), 50.5 bits, E=8e-17
• PF07992: Pyr_redox_2
  • amino acids 115 to 411 (297 residues), 71 bits, E=5.4e-23
• PF13450: NAD_binding_8
  • amino acids 119 to 155 (37 residues), 26 bits, 4.3e-09
• PF00037: Fer4
  • amino acids 501 to 523 (23 residues), 21.1 bits, see alignment (E = 9.4e-08)
  • amino acids 561 to 581 (21 residues), 27.7 bits, see alignment (E = 7.8e-10)
• PF13534: Fer4_17
  • amino acids 506 to 580 (75 residues), 23.7 bits, E=2.5e-08
• PF12838: Fer4_7
  • amino acids 506 to 581 (76 residues), 43.1 bits, E=2.2e-14

Best Hits

KEGG orthology group: None (inferred from 91% identity to vap:Vapar_5479)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Protein Sequence (600 amino acids)

>ABID97_RS28065 FAD-dependent oxidoreductase (Variovorax sp. OAS795)
MQRTDIANPAYFHKVVDCQYACPAHTPVPEYIRMIAQRRYSDAYMINWASNVFPGILGRT
CDRPCEPACRRGRVEQSNAQDPEPVAICRLKRVAADMKDDVRARMPTLAPSNGKRIACIG
AGPASLTVARDLAPLGYEVTVFDADAKAGGFIRTQIPRFRLPESVIDEETGYILDLGIDF
RGGTRIGSMAALMAEGWDSIFVGCGAPRGRDLELPGRQEAAAAIHIGIDWLNSVSFGHVT
RIGRRVIVLGGGNTAMDCCRSARRLGGTDVKVIVRSGFDEMKASPWEKEDAQHEGIPIIN
FHVPRAFVSEEGRLVGMRFERVRAAYDEHGRRTLVPTGEPDAFFECDEVLVAVGQENAFP
WIERDCGIAFDSKSGLPVLDENTFQSSVPRVFFGGDAAFGPKNIITAVAHGHEAAVSIDK
LLRAEPVYVRPAPMTNLVSQKMGIHEWSYDNDTSNDLRYKVPWAKAETALASIRVEVELG
FDAATAFKEAERCLNCDVQTVFNETACIECDACVDICPMDCISFTANGEEAELRTRLKAP
ALNLAQDLYVSGGLKTGRVMVKDEDVCLHCGLCAERCPTGAWDMQKFLLKMTPAGQGVAS