Protein Info for ABID97_RS27860 in Variovorax sp. OAS795

Annotation: acyl-CoA desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details PF00487: FA_desaturase" amino acids 50 to 306 (257 residues), 114 bits, see alignment E=5.1e-37

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>ABID97_RS27860 acyl-CoA desaturase (Variovorax sp. OAS795)
MEVAAFTTRLRTELREAGVFRNDDAGYWVRGLWVLIVTACVWIAFLSADAWAARAAVAIL
AGYIGVQSSAIAHEAGHGAVTRDRKWSWFVGRLFMSTIIGASYSAWIGRHGPHHVHPNSR
KDPDVRPSLFSFNETDAIAAKGLAAWCTRKQHVLLIPLSTLMGFSLKIAGWKHVVRRPAA
EWVDLTLLILHAAIWIVLPAFWIGIANSLLNYVLLTWVEGAYLAFVFLANHLGGPTSEEA
CAWPPSLRQIVTARNLPSNRLLTHLCIGLNTHIEHHLFGNLPATRLSEARNITRRICQSH
GVPYRECTLGQAFAEVHRYNRRMADAARQAQRSRRSLACEAGG