Protein Info for ABID97_RS27805 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 47 to 313 (267 residues), 141.8 bits, see alignment E=1.2e-45

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 48% identity to vpe:Varpa_5619)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>ABID97_RS27805 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MARYETGFEDGRRLLRGKQERLAYGLLAVALVAAPWVLPAYHIGEATFILIMCVASLGLM
MLTGFTGQVSLGQSAFVGIGAYIHTILLTQGVPLPVSLLLTTAGAALGGLLVGMPAIRVS
GLHLAMVTMAFAIVCEHVIGRWKSVTAGHSGMAVPDPTLFGLSLGGPRAFYFLCLVVLAV
VLILLVNLMRSATGRAFIGIRDSEAAAQGLGIDVARTKVLAFSLSAACSGLAGALLAHQM
QHITPEAFGLALSLQLVLMVFIGGLGSLRGAILGAILIGLLPSFISSLKEALPAKLGAQF
GLELFVYGAVLTFFVLLEPGGLNARWVRIRKVLAEFPWVRKSSVHKTKVYMKSERYR