Protein Info for ABID97_RS27460 in Variovorax sp. OAS795

Annotation: malonate decarboxylase acyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 TIGR03130: malonate decarboxylase acyl carrier protein" amino acids 9 to 104 (96 residues), 123.8 bits, see alignment E=1e-40 PF06857: ACP" amino acids 26 to 104 (79 residues), 93 bits, see alignment E=5.7e-31

Best Hits

Swiss-Prot: 81% identical to MDCC_BURCE: Malonate decarboxylase acyl carrier protein (mdcC) from Burkholderia cepacia

KEGG orthology group: K13931, malonate decarboxylase delta subunit (inferred from 94% identity to vap:Vapar_5373)

Predicted SEED Role

"Malonate decarboxylase delta subunit" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>ABID97_RS27460 malonate decarboxylase acyl carrier protein (Variovorax sp. OAS795)
MSDVPAGLETLDFSFSGGRPAGAFAPVLVGVVGSGNLEVMLEPAAGTACAVRVETSARGF
GPIWQAVMDDFHARHPLAGVRVSINDMGATPAVVSLRLDQAVAEIAGGRP