Protein Info for ABID97_RS27095 in Variovorax sp. OAS795

Annotation: nitric oxide reductase transcriptional regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 PF01590: GAF" amino acids 17 to 145 (129 residues), 33.4 bits, see alignment E=1.9e-11 PF00158: Sigma54_activat" amino acids 184 to 349 (166 residues), 233.2 bits, see alignment E=4.3e-73 PF14532: Sigma54_activ_2" amino acids 184 to 354 (171 residues), 78.3 bits, see alignment E=2.1e-25 PF07728: AAA_5" amino acids 207 to 325 (119 residues), 36.6 bits, see alignment E=1.4e-12 PF00004: AAA" amino acids 207 to 340 (134 residues), 21.6 bits, see alignment E=7.7e-08

Best Hits

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 87% identity to vap:Vapar_6323)

Predicted SEED Role

"Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (528 amino acids)

>ABID97_RS27095 nitric oxide reductase transcriptional regulator NorR (Variovorax sp. OAS795)
MTTNSVNQTTEGDGSRYRPLLAAVRGLVRCDAAALLQLDADVLRPVAVDGLSDETLGRQF
PVAAHPRFARLLESGRGLRFAHDCGLPDPYDGLVAGQPGILPVHDCMGAPLRLRGAIWGL
LTLDALEPGAFETVTPAQLDAMVSLVETGIEAAHTIQEMEARAMREHAVAQALRSGRGTT
RELLGSSAAMKQLYNEIDTVAVSDLTVLLLGETGVGKDLVAQRLHARSQRRDQPLVQVNC
AALPETLADSELFGHKRGAFTGAVQDRSGKFEIADGGTLFLDEVGELPLTVQAKLLRVLQ
SGEVQRPGSDRTLKVDVRVIAATNRDLPAAIAQGRFRADLYHRLSVYPLVVPPLRERGRD
VVALAGGFLEENQHRLGARNLRLSPASKAALLAHGWPGNVRELEHVISRASLRAFTEQRR
GARWTAIEPHHLALDGAAVGNVESVSPVLPATSPTPATSPSGLAATGGTLRDATEAFQRA
WLADLLARHHGHIANAAREAGIDRSNFHRMLRKMGLRPAARESVNARG