Protein Info for ABID97_RS25520 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 223 to 250 (28 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 293 (284 residues), 110.8 bits, see alignment E=3.4e-36

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 90% identity to pol:Bpro_0987)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>ABID97_RS25520 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MSGTVVLAQLLNGLQYGVLLFLLAAGLTLVFGIMSFVNLAHGSLYMMGAYFAASAFQYTG
SFAWAVAAATGGSLLLGLALEFVAVSRLYGRDHLDQVLATFGLVLFFNELVRIVWGSQPV
FLQVPEFLSGAIDIGGFSYPSYRIVILAVGLAVAVGSWLLINKTKVGMLIRAGAVNPAMV
AALGVNIRLLNAMLFAVGAMLAGLAGAMAGPILSVQSGMGESVLITTLVVIVIGGIGSVT
GAFHAALIVGTVDTMGRVFLPVVLRQVAERSFADAAGPALASMLVYLLMAVVLAWRPQGL
FPAHR