Protein Info for ABID97_RS25515 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 37 to 297 (261 residues), 115.1 bits, see alignment E=1.6e-37

Best Hits

KEGG orthology group: None (inferred from 86% identity to pol:Bpro_0988)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>ABID97_RS25515 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MMHLPSRPSTWVPLLALLLLAGVPFIALATGQTFYIGFFARIIIYAIAACALNIALGYGG
LVSFGHSLFLGLGAYAVGLASFHGVGSGWVHLALCLAACATVALVTGAISLRTRGIAFIM
ITLAFAQMGYFLFVSLKNYGGDDGLPIALGSRFGPVDLSSPASVYAVAFIVLVLSIWWLA
RLRVAPFGMVIRGARQNARRVSAAGIPVVRYQLLAYVMSGMLCGVAGLLLANLNAFASPG
TLAWSVSGELIVIVVIGGLGTVFGPLMGALVFLGLEEVLKGFTEHWMVVFGPLIVLVALL
GKRGIVGLLERLDAHVPKVAGPSASFEHAGTAANTLSAAEGSSS