Protein Info for ABID97_RS25430 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 246 to 270 (25 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 31 to 294 (264 residues), 78.8 bits, see alignment E=2e-26

Best Hits

KEGG orthology group: None (inferred from 98% identity to vpe:Varpa_3806)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>ABID97_RS25430 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MNSLRRTDASLLGLLAVLCAAAFIAPSWLMSLLAVALAKGLVALGLLLLLRAGLVPFGHA
LYYCLGGYVAGLGTPWLGIRDTLLLLALASLLSGAVAFAAGFLMRRYRGIFFAMLSMALS
MILYGVLLKSQSLGSSDGFTVARASFFAMQTAGVGAIRSVYLLTAVVTLLAAWGVSRYLT
TAMGHVGPAIRENEVRVEYLGCSPSRVIHREYTASGALAGGAGALVAILVGQVDPGMGFW
MTSGEFVFIAILAGAGGIWGSLAAAFVLEGIHALAFEYAPQYWKFVLGATLLLLIVRFPS
GLSSMLANRAGARS