Protein Info for ABID97_RS24730 in Variovorax sp. OAS795

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 78 PF02954: HTH_8" amino acids 34 to 71 (38 residues), 47.8 bits, see alignment E=4.7e-17

Best Hits

Swiss-Prot: 61% identical to FISL_NEIMA: Putative Fis-like DNA-binding protein (NMA1632) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K03557, Fis family transcriptional regulator, factor for inversion stimulation protein (inferred from 100% identity to vap:Vapar_4631)

Predicted SEED Role

"DNA-binding protein Fis" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (78 amino acids)

>ABID97_RS24730 Fis family transcriptional regulator (Variovorax sp. OAS795)
MSKKHIEDCVRTSLDSYFRDLRGTEPDGMYEMLVRVVEKPLLDVVMTRAEGNQSKAAQWL
GLNRNTLRKKLVEHKLLK