Protein Info for ABID97_RS23305 in Variovorax sp. OAS795

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 TIGR01048: diaminopimelate decarboxylase" amino acids 16 to 423 (408 residues), 513.6 bits, see alignment E=1.6e-158 PF02784: Orn_Arg_deC_N" amino acids 53 to 292 (240 residues), 225.9 bits, see alignment E=8.1e-71 PF00278: Orn_DAP_Arg_deC" amino acids 68 to 381 (314 residues), 87.7 bits, see alignment E=7.6e-29

Best Hits

Swiss-Prot: 54% identical to DCDA_PSEAE: Diaminopimelate decarboxylase (lysA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 94% identity to vap:Vapar_1136)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>ABID97_RS23305 diaminopimelate decarboxylase (Variovorax sp. OAS795)
MTTNASPLPGHPHVVQRDDALHVEGVSLDALAREHGTPLFVYSKQWMLDALAAYQRGFEG
RDALICYAMKANSSLGVLRVFAEAGCGFDIVSGGELARVLAVGADPSKIIFSGVGKSRGE
MRQALAAGIACFNVESEAELDVLNEVALAEGARAPISIRINPNVDPKTHPYISTGLKGNK
FGIAHDRAVEAYRHAARLPGLEVVGIDCHIGSQITEASPYLDACDRILDLVEAIEAAGVP
IHHLDFGGGLGIDYNGEVPPKADALWQQLLARLDARGFGQRKLVIEPGRSLVGNAGVCVT
EVLYTKPGEDKNFCIVDAAMNDLPRPAMYQAFQKIVPLRIRAGGATTYDVVGPVCESGDW
IGRDRALNVVAGDLLAVLSAGAYCMSMASNYNTRGRAAEVLVSGQSATLIRRRETMEDQL
RSEQVEG