Protein Info for ABID97_RS23245 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 27 to 27 (1 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 229 to 254 (26 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 326 to 350 (25 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details amino acids 391 to 409 (19 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 378 (359 residues), 86 bits, see alignment E=1.2e-28

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_1234)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>ABID97_RS23245 MFS transporter (Variovorax sp. OAS795)
MGPATGASARVPAAAFAVVLGGVSAALHLGKLPPAVPALQASLGIGLVEAGFLLSLVQVA
SMTLGLAAGLAADTIGLRRSMLAGLLVLTAASLLGGAVGAGLLGAAHAVQWLLFLRAVEG
IGFLLAVMPGPGLIRALTPPGADKAALGVWGAYMPLGVALALLLGPALIGWGGWGDWWWA
LSAVSAAAALWLWAAVPADGLRSGTPAASATPDGWSSRLRATVGARAPWMIASSFAVYSA
QWMAVIGFLPAIYAGAGVPAGWNAVLTAIAAAMNIVGNLAGGRWLQRGVAPERLLQGGFL
AMALGGVAAFAQVGQGADALGLPPALRYAAVCAFSLGGGMVPATLFLLGVRLAPGPATVS
TTIGLMQQASSLGQFLAPPAVAWVAHRVGGWHWTWAATLACSLAGMVLARRLGRIRLAAG
VA