Protein Info for ABID97_RS22870 in Variovorax sp. OAS795

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF00005: ABC_tran" amino acids 28 to 179 (152 residues), 105.7 bits, see alignment E=3.1e-34 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 229 to 315 (87 residues), 86.5 bits, see alignment E=4.9e-29 PF08352: oligo_HPY" amino acids 231 to 296 (66 residues), 66.1 bits, see alignment E=3e-22

Best Hits

Swiss-Prot: 61% identical to Y3404_BRUSU: Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 (BRA0404) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 97% identity to vpe:Varpa_1300)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>ABID97_RS22870 ABC transporter ATP-binding protein (Variovorax sp. OAS795)
MTTAAPLIEVRGLKKYFGTSARPVRAVDDVSFAIQPGETLGLVGESGSGKSTIGRTVLRL
VERTGGQVLYRGDDIGALSGERMRKLRSKLQIIFQDPYASLNPKMRISAILGEALSTHGL
HKGAAARDKRIAELLETVGLRAEHASRFPHEFSGGQRQRIGVARALAVEPEFIVADEPLS
ALDVSIQSQVINLLADLRERLGLTMLFISHDLDVVEYLCDRVVVLYLGKVMEVAGTDELF
ARPSHPYTQALLAASPKPDPTLATERIALKGDIPSPISPPSGCVFRTRCPHAIEACAQTV
PPLDEISPGHYSACIRKELLSHIAA