Protein Info for ABID97_RS22815 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 15 to 40 (26 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 94 to 327 (234 residues), 62.5 bits, see alignment E=1.8e-21

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 92% identity to vap:Vapar_1229)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>ABID97_RS22815 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MDLQIALLLGQDGIVNGAVYGLMALALVLVFSVTRVIFIPQGEFVAFGALSMAVLQTGRV
PATLWLLVALAAMVLVVEAWRWKRGTVVDWGSALTWCVALPALASVLVLWLKPTSMAAQA
LTTLVLIAPLGPLLYRLAYRPLADASVLMLLIVSVALHGVLVGLGLLFFGAEGYRTTAFS
EERLDIGGIPVSGQSLVVVGITLALVIAMFFFFGRSMVGKALRATAINRVGARLSGIPTE
LSGDLSFALAALIGAVSGLLIAPLTTVYYDTGFLIGLKGFVAAIVGGLASYPLALAGAIL
VGQLEAFASFWASPFKEVLVFTLIIPVLWWRSLHSHHVEDEE