Protein Info for ABID97_RS22675 in Variovorax sp. OAS795

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 86 to 112 (27 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details PF00892: EamA" amino acids 24 to 158 (135 residues), 69 bits, see alignment E=2.7e-23 amino acids 176 to 312 (137 residues), 55.8 bits, see alignment E=3.2e-19

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_1255)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>ABID97_RS22675 DMT family transporter (Variovorax sp. OAS795)
MTKSAVQTGIPFSAGGAKKSIGAGLVLASLGAIAFSGKAIIVKLAYRYGVDAITLIMLRM
LFALPLFAVMAWWAGRGKPALTLRDWLGVIGLGFSGYYLASFLDFAGLAYISASFERLIL
YLNPTLVLLFGWLMYRRRATRPQVLGMIVSYAGVLLVFGHELWIGGGGKGGGAAAWGAFL
VFLSAVSYAGYLVYSGEFVKRLGSLRLVGLATTVACVLCILQFVLARPMSAALQVAPEVI
WLSVLNATLCTAVPVLMVMMAIERIGPAMAAQTGMIGPLSTILMGVVILGEPFTAWIAAG
TVLVIAGIFVFTRTGR