Protein Info for ABID97_RS22125 in Variovorax sp. OAS795

Annotation: xanthine dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02963: xanthine dehydrogenase, small subunit
  • amino acids 11 to 515 (505 residues), 668.1 bits, E=3.2e-205
• PF00111: Fer2
  • amino acids 15 to 63 (49 residues), 23.9 bits, 6.6e-09
• PF01799: Fer2_2
  • amino acids 127 to 194 (68 residues), 92.7 bits, E=2.5e-30
• PF00941: FAD_binding_5
  • amino acids 237 to 404 (168 residues), 153.7 bits, E=8.4e-49
• PF03450: CO_deh_flav_C
  • amino acids 412 to 514 (103 residues), 117.7 bits, E=4.8e-38

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 86% identity to vap:Vapar_3907)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• ureide biosynthesis (5/7 steps found)
• superpathway of purines degradation in plants (12/18 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (2/7 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (2/10 steps found)
• theophylline degradation (1/9 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Protein Sequence (547 amino acids)

>ABID97_RS22125 xanthine dehydrogenase small subunit (Variovorax sp. OAS795)
MSTERNNIQPVRFFHRGKIVEIRGVHPTRSVLDWLREDAHCTGTKEGCNEGDCGACTVVI
GELASAADAPGAVGGLQLQTVNACIQFLPTLHGKALFTVEDLKDQCPANAPAATEVQGQD
KRPHPVHRLHPVQQAMVDCHGSQCGFCTPGFVMSLWSAYEHHQAEGTQPTRQQLADELSG
NLCRCTGYRPILDAGQRMFDLPAVRLDTEPVVAALTALRGSEGFDYAAPLGARMDHFHAP
RTIAQLAALRQEKPGAQLLSGSTDVGVWVNKQFRDLGDIIYVGDVAEMKTVEVRQDDTDG
ELYIGAGASLESAFEALVQRVPSLEDVWLRFASPPIRHAGTMGGNVANGSPIGDSPPVLM
SLDAEIELRRGDAVRRMPLSAFYVDYMKNQLQSGEFVQGLAVPLAAMQRQVRAYKISKRF
DCDISALCAGFAIEFDAGSDMVQAVRLAFGGMAATVKRAAAAEAALVGKPWTQASVNAAR
QALSQDFQPLSDMRASAGYRLQVAQNLIQRFWLETRTEDALSLEETSVWSAMPHSTTIKA
DKAAQGV