Protein Info for ABID97_RS22095 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 278 (269 residues), 130.9 bits, see alignment E=2.6e-42

Best Hits

Swiss-Prot: 46% identical to TSGCD_HALVD: Putative glucose ABC transporter permease protein TsgC13 (tsgC13) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 99% identity to vap:Vapar_3901)

Predicted SEED Role

"Putative deoxyribose-specific ABC transporter, permease protein" in subsystem Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>ABID97_RS22095 ABC transporter permease (Variovorax sp. OAS795)
MDSYALLLGSTLSAGTVLAIAALGLLINEKAGIVNLGAEGMMLCAAIAGFATVVITHNPW
LGFLAGMAAGALLAAFFGVLVIWLNTNQYATGLALSLFGVGFSAFVGINFVQAKLPESVS
YAVPVLSDIPLVGPALFRHHPMVYFAVVLTFGLIWFLYRTRAGLVLRSVGESPESAHALG
YPVRRIRFLAVIVGGALCGLAGAYLSTVYTPLWVEGMVAGRGWIALALTTFATWRPIRVL
LGAYLFGGVSMLGFHLQSSGVDVPPQFLSMLQYIAPIVVLALISRNPAFIRINMPASIGK
PFYPGS