Protein Info for ABID97_RS21740 in Variovorax sp. OAS795

Annotation: methionine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 50 to 220 (171 residues), 54.9 bits, see alignment E=4.8e-19

Best Hits

Swiss-Prot: 44% identical to METI_ECOLI: D-methionine transport system permease protein MetI (metI) from Escherichia coli (strain K12)

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 96% identity to vpe:Varpa_4375)

MetaCyc: 44% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>ABID97_RS21740 methionine ABC transporter permease (Variovorax sp. OAS795)
MFENIAPILPELWVATGQTFLMLAIGLSAAVLIGGPLGILLFLLGPGQSLDNRPAFLVLN
WIVNTVRSFPFIILLVALVPFTRVIAGTSIGPLAAAVPLSFAAIPYFARLVDQCLREVPR
GVIEAAHAMGASELQIVWRVLVVEARAGLVLALTVLAVSFLSYSAIAGVVGGGGIGDLAI
RYGYYRFQTDVMVLTVALLVVLVQILQFVGNTTARRLDKR