Protein Info for ABID97_RS21580 in Variovorax sp. OAS795

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00005: ABC_tran" amino acids 24 to 165 (142 residues), 129 bits, see alignment E=2e-41 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 38 to 327 (290 residues), 358.9 bits, see alignment E=1.1e-111 PF08402: TOBE_2" amino acids 282 to 360 (79 residues), 47.1 bits, see alignment E=2.2e-16

Best Hits

Swiss-Prot: 47% identical to POTA_RUEST: Spermidine/putrescine import ATP-binding protein PotA (potA) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 92% identity to vap:Vapar_4696)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>ABID97_RS21580 ABC transporter ATP-binding protein (Variovorax sp. OAS795)
MTQEPLVRFQRVQKTYDGEHLVVRQLDLDIHRGEFLSLLGPSGSGKTTTLMMLAGFESPT
SGEILLEGKPITGTPPHKRHFGMVFQNYALFPHLSVGQNVAYPLTVRKVSKDEQQRRVQR
ALDMVQLRGMTDRLPGQLSGGQQQRVALARALVFEPQLVLMDEPLGALDKQLREHMQIEL
KDLHRQLGVTFVYVTHDQGEALTMSDRVAVFNEGVIQQLDTVGRLYETPSNRFVAGFVGD
NTVLKGQLSRGGEQAEMKLPDGRVLHGLNVSGAAAGTAVEACIRPERVVLHRKPDAQGAN
MLEAVVARVIYFGDHLRLLCSVGGGQAEATVKLPLTGVGGIATPQAGESVALEFPVAHAR
MYAL