Protein Info for ABID97_RS21530 in Variovorax sp. OAS795

Annotation: DSD1 family PLP-dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF01168: Ala_racemase_N" amino acids 17 to 241 (225 residues), 118 bits, see alignment E=5e-38 PF14031: D-ser_dehydrat" amino acids 258 to 363 (106 residues), 82.1 bits, see alignment E=3.8e-27

Best Hits

Swiss-Prot: 76% identical to DTHAD_DELSH: D-threo-3-hydroxyaspartate dehydratase (dthadh) from Delftia sp. (strain HT23)

KEGG orthology group: None (inferred from 78% identity to vap:Vapar_6194)

MetaCyc: 76% identical to D-threo-3-hydroxyaspartate ammonia-lyase (Delftia sp. HT23)
RXN-11767 [EC: 4.3.1.27]

Predicted SEED Role

"Type III PLP / low-specificity D-threonine aldolase" in subsystem Serine-glyoxylate cycle or Threonine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>ABID97_RS21530 DSD1 family PLP-dependent enzyme (Variovorax sp. OAS795)
MHTPTHLAALGTPAALIDLPRMQRNIDRMQARMDALGKRFRPHVKTTKCTPVVRAQLAAG
AQGITVSTLKEAEQFFADGITDILYAVGMAQHRLAQALALRRKGCDLKIITDSAASAAAI
SAFGRAQGEPFEVWIEIDTDGHRSGIKPGEAALLEVGRILHAGGMVLGGVLTHAGSSYDL
DTHEALAALAEQERAGCVQAAERLRAAGLPCPVVSVGSTPTALSAEQLDGVTEVRAGVYV
LFDLVMKNVGVCEPQDIALSVLTTVIGHQPDKGWAIVDAGWMAMSRDRGTQKQKRDHGYG
QVCSVDGTVLEGYLLSGANQEHGILSREGAPDPDIEARFPIGTQLRILPNHACATGAQFP
GYHALAPDGTLETWSRLHGW