Protein Info for ABID97_RS21275 in Variovorax sp. OAS795

Annotation: lactoylglutathione lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF00903: Glyoxalase" amino acids 2 to 124 (123 residues), 94.7 bits, see alignment E=1.1e-30 TIGR00068: lactoylglutathione lyase" amino acids 2 to 132 (131 residues), 212 bits, see alignment E=1.4e-67 PF13669: Glyoxalase_4" amino acids 5 to 108 (104 residues), 30.9 bits, see alignment E=5.6e-11 PF18029: Glyoxalase_6" amino acids 8 to 124 (117 residues), 26.9 bits, see alignment E=1.3e-09 PF21701: GLOD4_C" amino acids 12 to 129 (118 residues), 29.4 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 78% identical to LGUL_ECO57: Lactoylglutathione lyase (gloA) from Escherichia coli O157:H7

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 92% identity to vap:Vapar_3703)

MetaCyc: 78% identical to lactoylglutathione lyase (Escherichia coli K-12 substr. MG1655)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>ABID97_RS21275 lactoylglutathione lyase (Variovorax sp. OAS795)
MRLLHTMLRVGNLQRSIDFYTQVLGMNLLRTSENPEYKYSLAFVGYGGGNPEQAEIELTY
NWGTESYELGTAYGHIALGVPDAYAACEKIKAAGGQVTREAGPVKGGTTVIAFVTDPDGY
KVELIQDKSKSQGQAGADALRAS