Protein Info for ABID97_RS20740 in Variovorax sp. OAS795

Annotation: FUSC family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details amino acids 431 to 449 (19 residues), see Phobius details amino acids 456 to 490 (35 residues), see Phobius details amino acids 495 to 495 (1 residues), see Phobius details amino acids 497 to 527 (31 residues), see Phobius details amino acids 529 to 549 (21 residues), see Phobius details PF12805: FUSC-like" amino acids 86 to 325 (240 residues), 105.1 bits, see alignment E=3.9e-34 PF13515: FUSC_2" amino acids 419 to 541 (123 residues), 79.3 bits, see alignment E=2.9e-26

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_3567)

Predicted SEED Role

"FIG00348290: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (747 amino acids)

>ABID97_RS20740 FUSC family membrane protein (Variovorax sp. OAS795)
MQGPRAALRIRAALRIALSQYVASGLTVALGLLVISAGAHLWLGAIAAASAAVGVIVTAP
PDLPGPRRGKFFQMLPAPLIGLPLFFLVQLLHTAPIRLGLVLVPATFVAFLAMAWGKRGI
PIAIAVMFSMIFSMATPAPTGMAEALERTWHFGLGAGLYVIWATLANHALNTRFRVQSVS
DVLYSLAALMRTEACQFTPRDDTRDIRETPAPVLGQLLREQAALADQLQATRDIVLESPR
TPRRQRLAAMLVIVLEMRDQLLASELDLDALKSHPAHAEALIEMRRVLEELADETTALGD
ALLWGRQPEAVADRRPRLASIHLSGEDGGANHGMPGPNAAMLARGLASRIGHINDEVLRL
SAMARGDAEPNLAVVRANWQMFVSPTDWSLMPFLTLWRWDAPPLRHAIRAALAIAAGYAI
AVSLPWGSHDYWILLTIVVVLRGSLSQTLERRNSRVAGTLLGSVLAVALLSAHPSPLMLL
AIVTISQAIAHSFAVRRYLITAVAATVLGLVQAHMLNTGAAPLFALFERIADTLIGAALA
WGFCYVLPSWERGQIPALVARTLTAQARHARLALGLGQLKAVDSSPELEWRLARREAFDS
LSALVQATQRSLSEPRAVQPPLEPLEHLQAHSYQLLAQLSAVKSMLVLRRDRLTPADIEG
PLERTAQRIETAIGTAPTSGPSLPESPGSTTVGGPIPLPDPFENDISPWLLRRLDLATAL
ATQLRDDAARILQPLEETQTTATAIAR