Protein Info for ABID97_RS20615 in Variovorax sp. OAS795

Annotation: uroporphyrinogen-III C-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01469: uroporphyrinogen-III C-methyltransferase" amino acids 11 to 252 (242 residues), 274.6 bits, see alignment E=4.2e-86 PF00590: TP_methylase" amino acids 14 to 230 (217 residues), 174.9 bits, see alignment E=1.1e-55

Best Hits

KEGG orthology group: K02303, uroporphyrin-III C-methyltransferase [EC: 2.1.1.107] (inferred from 91% identity to vap:Vapar_3532)

MetaCyc: 44% identical to CobA (Pseudomonas denitrificans (nom. rej.))
Uroporphyrinogen-III C-methyltransferase. [EC: 2.1.1.107]; 2.1.1.107 [EC: 2.1.1.107]

Predicted SEED Role

"Uroporphyrinogen-III methyltransferase (EC 2.1.1.107)" in subsystem Coenzyme B12 biosynthesis or Dissimilatory nitrite reductase or Experimental tye or Heme and Siroheme Biosynthesis (EC 2.1.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>ABID97_RS20615 uroporphyrinogen-III C-methyltransferase (Variovorax sp. OAS795)
MNRPTASLATGSCTLVGAGPGDPELLTIKAVKAIQAATVLLVDDLVSDSILAAYARPGAR
IVHVGKRGGCKSTPQAFIERLMITAAREGETVVRLKGGDPFIFGRGGEEVEHLREAGIEC
TVVNGITAGLAAVTSLGVPLTHRDHAQGVVFVTGHARTGAGAHEDATDWRALAATAHNAR
LTLVIYMGVAGASHIERELLQGLPGDTPVAVVQHASLPQQRHIATTLDRLQAGIAEAGLA
SPAVIVVGDVLRGLAAAALPAGTDAGRFGT