Protein Info for ABID97_RS20310 in Variovorax sp. OAS795

Annotation: DNA mismatch repair endonuclease MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 TIGR00585: DNA mismatch repair protein MutL" amino acids 15 to 316 (302 residues), 295.5 bits, see alignment E=3.3e-92 PF02518: HATPase_c" amino acids 34 to 90 (57 residues), 34.9 bits, see alignment 3.6e-12 PF13589: HATPase_c_3" amino acids 37 to 135 (99 residues), 48.9 bits, see alignment E=1.4e-16 PF01119: DNA_mis_repair" amino acids 220 to 335 (116 residues), 125.5 bits, see alignment E=1.7e-40 PF08676: MutL_C" amino acids 441 to 583 (143 residues), 152.3 bits, see alignment E=1.4e-48

Best Hits

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 91% identity to vap:Vapar_3466)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (627 amino acids)

>ABID97_RS20310 DNA mismatch repair endonuclease MutL (Variovorax sp. OAS795)
MSALPTSLAPAERRPIRELPDELISQIAAGEVVERPASVVRELLDNALDAGARQVTVRLA
AGGVRLISVEDDGQGIPREELTVALRRHATSKIASLNDLETVGTMGFRGEALAAISAIAE
LSILSRFAGADSAFALDGRTGELRPVARAVGTTVEVRELFFATPARRKFLKTDATELAHC
IEAVRRHALARPEVGFSVWHDGKLMEQWRAADRREQRLADALSDDFVAQSVAVDHLGGAV
RVAGRAGIPDAARSRGDQQFFYVNGRFVRDKVLSHAVRSAYEDVLHGQRQPVYALYLDID
PSRVDVNVHPTKIEVRFRDGREVHQAVRHAIENALAAPRAGDAAAPLGTQQPFFKPGVPA
SGATWAQPGINFTARERGAGDFEAMWPRRTEAAPHASEAAATGWPLAGTAPMAFRAPAAL
PGESLQALATHEEAWPLGRALAQLQGIYILAENSQGLIVVDMHAAHERIVYERLKTQLDG
AAITSQPLLIPATFAATPQEVATAEACAAVLPTLGLEITPFSPRTLAVRAVPGTLADGDP
VELARSVLAELALHDASSVVQRAQNELLSTMACHGAVRANRKLTIDEMNALLRQMEATER
SDQCNHGRPTWRQLSIRELDALFMRGR