Protein Info for ABID97_RS19990 in Variovorax sp. OAS795

Annotation: DNA internalization-related competence protein ComEC/Rec2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 825 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 94 (27 residues), see Phobius details amino acids 296 to 321 (26 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 404 to 422 (19 residues), see Phobius details amino acids 436 to 488 (53 residues), see Phobius details amino acids 490 to 491 (2 residues), see Phobius details amino acids 493 to 516 (24 residues), see Phobius details amino acids 521 to 544 (24 residues), see Phobius details PF13567: DUF4131" amino acids 41 to 229 (189 residues), 89.7 bits, see alignment E=2.6e-29 TIGR00361: DNA internalization-related competence protein ComEC/Rec2" amino acids 186 to 792 (607 residues), 342.8 bits, see alignment E=3.5e-106 PF03772: Competence" amino acids 274 to 539 (266 residues), 187.1 bits, see alignment E=6.1e-59 TIGR00360: ComEC/Rec2-related protein" amino acids 295 to 479 (185 residues), 85.2 bits, see alignment E=6.6e-28 PF00753: Lactamase_B" amino acids 575 to 764 (190 residues), 38.4 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 88% identity to vap:Vapar_3404)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (825 amino acids)

>ABID97_RS19990 DNA internalization-related competence protein ComEC/Rec2 (Variovorax sp. OAS795)
MTAVRASGGVAAGSWAFAALGGTLLGAALQLQQPRLWGAGAYAACLVAGLAGLALLSRRW
PKFRGLPASPLFASVPLFAALVFGTLAGGGLAGWRACAYAKGALDPALEGRDLQVVGVVG
QMPQRSDGGTRFRLDVESAHWADATGAPAPRVPSRIALGWYRDDASLRGRAPEGRAAASA
GAAAPLHAGERWRLTVRLKAPHGNLNPHGFDSELWLWEQGVHASGYVRTGARDAAPARLQ
ATWQHPIERAREAVRDAVFERVPDARQAGVIAALVTGDQGAIERSDWDIFRATGVAHLMS
ISGLHITMFAWLAAHAVGALWRRSGKLMLRVPAPQAALVGGVLLAGLYALFSGWGVPSQR
TVWMLATAALLRLTGRRWPWPHVWLLIAAVVVTIDPWALMQAGFWLSFVAVGVLFTTGFM
RPAGEKTGPAARLLAFFREQWVITLALTPLSLLLFQQVSVVGLLANAVAIPWVTLVITPL
AMLGTAIAPLWDLAAWAVQALAVLLRWLAALPYATLSMAAPPVWMAACGVAGGVLLAMQL
PWSLRTLGLPFLLPVLLWQAPRPAMGEFALLAADIGQGNAVLVRTASHSLLYDAGPRYSL
ESDAGHRVLVPLLRALDERLDMLLLSHRDIDHTAGAVAVLAMQPKAELLSSIEAAHPLQS
LRPARRCEAGQRWTWDGVDFEILHPVAADYLSFTKPNAVSCVLRIGNGRATVLLAGDIER
LQEAALVSRTPALRADVLLAPHHGSKTSSSAVLLDAVRPRLALVQAGYRNRFGHPAPEVV
GRYAAHGVRLVENVPCGAVSWRSEAPGEVGCERERNARYWHHRLP