Protein Info for ABID97_RS19940 in Variovorax sp. OAS795

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 285 (202 residues), 72.5 bits, see alignment E=1.9e-24

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 98% identity to vpe:Varpa_2226)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>ABID97_RS19940 sugar ABC transporter permease (Variovorax sp. OAS795)
MNATNKPINQKAWWLVLPVLICVAFSAIVPLMTVVNYSVQDIISPERRVFVGTEWFASVM
RDDELHQALWRQLGFSLSVLLVEIPLGICLALSMPAKGWKSSAVLVVVALSLLIPWNVVG
TIWQIYGRADIGLLGHALQKLGVDYNYTGSATDAWLTVLVMDVWHWTPLVALLCFAGLRS
IPDAYYQAARIDGASKFAVFRYIQLPKMRGVLMIAVLLRFMDSFMIYTEPFVLTGGGPGN
ATTFLSQYLTQKAVGQFDLGPAAAFSLIYFLIILLFCFVLYNWMQRVGTQEVEKEQ