Protein Info for ABID97_RS19800 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 68 (26 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 275 to 300 (26 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 290 (269 residues), 57.8 bits, see alignment E=1.4e-19 amino acids 274 to 390 (117 residues), 45.7 bits, see alignment E=6.6e-16 PF12832: MFS_1_like" amino acids 24 to 369 (346 residues), 215.8 bits, see alignment E=1.5e-67 PF03825: Nuc_H_symport" amino acids 29 to 376 (348 residues), 46.4 bits, see alignment E=4.5e-16

Best Hits

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 97% identity to vap:Vapar_3357)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>ABID97_RS19800 MFS transporter (Variovorax sp. OAS795)
MPTPPPVAAGRGHLLAFAGLSASYFAHIGFFNPYLPLWLKDLGLPIFTISLLASVQSVTR
VFAPYAWGALSDHTGQRVKLLRFSAAVALASSFGLWWHGGAWWLALVLLVMFTHTSSMMS
LTEAAMAQLVAGDWGRYGRIRLCGSAGFLVTVFFAGEWFERFGMKHFPAWAAGTLAVVLI
ATMKLPDIREPVAAHDAVKEPIGPVLRIPAVRWFFASLFFQVMSHFSVYAFFSLYLDSLG
YGKSVIGLLWALSVVAEIVWFFLQGRLIGLLPMPRWMLVCGIAAVARLGLTAGLGGWIAA
LVVAQWLHALSFAAHHTTCIAVVSRRFPGRLRGRGQALFTVIGYGFGGVLGVLLGGAVAQ
EFGYRTMFALAAVLAAVGSLCAWRVVTLERTATAAG