Protein Info for ABID97_RS19675 in Variovorax sp. OAS795

Annotation: nitronate monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03060: NMO
  • amino acids 4 to 344 (341 residues), 257.3 bits, E=5.3e-80
• PF04481: DUF561
  • amino acids 151 to 240 (90 residues), 27 bits, E=5.2e-10
• PF01070: FMN_dh
  • amino acids 189 to 244 (56 residues), 25.4 bits, E=1.5e-09

Best Hits

KEGG orthology group: K00459, nitronate monooxygenase [EC: 1.13.12.16] (inferred from 88% identity to vap:Vapar_3305)

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.9)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (31/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (31/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (31/34 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• alkylnitronates degradation (2/2 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.13.12.16, 1.3.1.9

Use Curated BLAST to search for 1.13.12.16 or 1.3.1.9

Protein Sequence (352 amino acids)

>ABID97_RS19675 nitronate monooxygenase (Variovorax sp. OAS795)
MASSLQHLLGIELPLIQSPMAGVQGSAMAIAVSNAGGLGSLPCAMLGPDAMRSELAAIRT
ATGKPYNVNFFCHTPPEPSAQREAAWRAALAPYYAEFGIDAAAIPTGPGRNPFSAEVAGV
LAEFSPPVVSFHFGLPPEPLLAQVRGWGAKILASATTVEEALWLESRGVDAVIAQGLEAG
GHRGHFLSHDLTAQLGTFALLPQVVRALRVPVIAAGGIADAQGVAAAMALGAAGVQVGTA
YMLSREATTSALHRAALKSEAARHTALTNLFTGRPARGIVNRVMRELGPIGPAAPEFPLA
TSGIAPLRAKAEAAGSGDFSPLWSGQNATGCRELPAAEITRALAQGFKPLAG