Protein Info for ABID97_RS19540 in Variovorax sp. OAS795

Annotation: phosphoethanolamine--lipid A transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 47 to 64 (18 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 108 to 124 (17 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details PF08019: EptA_B_N" amino acids 88 to 235 (148 residues), 135.2 bits, see alignment E=1.8e-43 PF00884: Sulfatase" amino acids 266 to 564 (299 residues), 185 bits, see alignment E=2.1e-58

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 92% identity to vap:Vapar_3282)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>ABID97_RS19540 phosphoethanolamine--lipid A transferase (Variovorax sp. OAS795)
MSFSRIEPAPVRRIGPAGAGSSHLAPARALWVRFDLWLARPRSAQKLVVWLAVYLAVAAN
WPLWNELARIGGAPSTYLPTIAAMGVLMVCATVALLSFTAWSRWMKPLWFAVVLLAAFVQ
HYMLEYRVVMDPTMIANVLQTDPNEARDLMSWRMAFHVLLVAVLPGLALWRARIVPMRFV
SKLWRNAALLLLAAALALVAAVSMNRQLAPLMRNNIHLRYMMNPVASLYSAGSVLIKPMF
KRSRKLIPITAGTTLGVSYAGQARPPMFVMVVGETARADHFGLNGYARDTTPELAARGVL
SYRDVHSCGTNTLASVPCMFSPLGKEGYESRKDDYENLVDVLQAAGLAVLWLDNQAGCKD
VCTRVPNASAFDSLSPAQKSALCDGEECLDDVMLQGLDERIAALPAERRAKGVVLVMHQM
GSHGPAYYKRSAPDVKRFLPECKTNALAECGHAELQNVYDNSIAQTDRFLARTIDWLKAQ
SGRYDPALLYVSDHGESLGEYGLFLHGVPYSFAPEAQKHVPMVTWFSDGMSQRRKLSRPC
MEAGLDTPLTHDNLFHTVLGLMDVGNATYKPALDALASCRNKA