Protein Info for ABID97_RS19375 in Variovorax sp. OAS795

Annotation: bifunctional 2-methylcitrate dehydratase/aconitate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 TIGR02330: 2-methylcitrate dehydratase" amino acids 13 to 483 (471 residues), 858 bits, see alignment E=8.6e-263 PF03972: MmgE_PrpD_N" amino acids 19 to 271 (253 residues), 320.6 bits, see alignment E=5.8e-100 PF19305: MmgE_PrpD_C" amino acids 288 to 465 (178 residues), 209.8 bits, see alignment E=2.6e-66

Best Hits

Swiss-Prot: 80% identical to PRPD_CUPNE: 2-methylcitrate dehydratase (prpD) from Cupriavidus necator

KEGG orthology group: K01720, 2-methylcitrate dehydratase [EC: 4.2.1.79] (inferred from 84% identity to axy:AXYL_01624)

MetaCyc: 78% identical to 2-methylcitrate dehydratase (Salmonella enterica enterica serovar Typhimurium)
2-methylcitrate dehydratase. [EC: 4.2.1.79]

Predicted SEED Role

"2-methylcitrate dehydratase (EC 4.2.1.79)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.2.1.79)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>ABID97_RS19375 bifunctional 2-methylcitrate dehydratase/aconitate hydratase (Variovorax sp. OAS795)
MSAPISNTRPEPDQVLVDIVDYVLAHRQITSALAFETARHCLVDTLGCGLEALEYPACTK
LLGPLVPGTLVPHGARVPGTPHQLDPVQAAFNIGTMIRWLDFNDTWLAAEWGHPSDNLGG
ILATADWLSRNAVAAGRQPLVMRDVLTAMIQAHEIQGCLALENSFNKVGLDHVVLVKVAS
TAVVARLMGLSRDEIVNAVSLAWVDGQSLRTYRHAPNTGSRKSWAAGDATSRAVRLALIA
KTGEMGYPSVLSARTWGFYDVLFKGQPFRFQRPYGSYVMENVLFKISFPAEFHSQTAVEA
GMALHAQLQRTGKTVDDIERVTIRTHEACIRIIDKKGPLDNPADRDHCIQYMVAVPMIFG
RLTAADYEDGVASDPRIDALRSRIVCVEDPRFTADYHDPEKRSIANALTVAFKDGTSLAE
VVVEYPIGHKRRRAEGIPLLEAKFRTNLARRFAQKQQQAILDVSLDAKKLDAMPVHAYVD
LYAAA