Protein Info for ABID97_RS18640 in Variovorax sp. OAS795

Annotation: aromatic-ring-hydroxylating dioxygenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF13577: SnoaL_4" amino acids 5 to 141 (137 residues), 39.5 bits, see alignment E=5.5e-14 PF00866: Ring_hydroxyl_B" amino acids 18 to 150 (133 residues), 83.9 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: None (inferred from 52% identity to bpe:BP2092)

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>ABID97_RS18640 aromatic-ring-hydroxylating dioxygenase subunit beta (Variovorax sp. OAS795)
MNVEDLLLHHEVSQFIYREARLQDNHEYDAWEALWTDDGVYWIPANGDTSDPELEMSIIY
DNRSRIALRVRQFHTGKRYSQSPRSPLRRVISNVEILENDGTALVVTANAIVFEAHARGD
TIWGSRNEYQLRREGGTLRMAGKKVVLTNNERALYSMAFLI