Protein Info for ABID97_RS18150 in Variovorax sp. OAS795

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 11 to 348 (338 residues), 92.9 bits, see alignment E=1e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>ABID97_RS18150 acyltransferase (Variovorax sp. OAS795)
MQKNGSRLEQLTSLRFFAALAIVFQHLRGEMGVPDVDIGLGQGVSFFFVLSGFILAYVYP
HLPDRKAIASFWRARIARIWPAHFASFLLGWWLLDYKIVPATAIANLALVQAWVPSWNFF
LSYNAVAWSISTEFFFYLCFPFLLHRWSATWRAKLAGAALLLLVLVWACGALALPVVTPT
NLNAFEPTQLGVLYISPLSRLLEFIVGMAAAQLFQTRKYTTGRRMGTAIEIGVLLLCLLN
VIASHYALEAIDAMFPDAPINQWIGPSSSFLSFAALIYVMAHGHGRVSAFLEQRPLVLLG
EISFSMYLVHQILILYFSNNKGSFARVGGQLDLVVFFGVLLLLSYLMWRCIELPARAVLT
GSAGSVRLDFKRLLGPASAALLLWITVATVFTRSGGANFISERDASLMTHAPIAPHSGSV
FGGRFELRGLDVRCLPDGIELDFAWQSRMDQPFGYMNALHLVDASGAILAQQDYGQPTRT
AMVKAGQIWRDRVFLPASKLQQSTTSIALAVYRGADLLAIDKGNTDWGGRRLVIPLPECQ
SPLN