Protein Info for ABID97_RS17545 in Variovorax sp. OAS795

Annotation: class II fumarate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR00979: fumarate hydratase, class II" amino acids 8 to 463 (456 residues), 762.5 bits, see alignment E=7.4e-234 PF00206: Lyase_1" amino acids 16 to 345 (330 residues), 376.7 bits, see alignment E=1.1e-116 PF10415: FumaraseC_C" amino acids 411 to 464 (54 residues), 89.1 bits, see alignment 2e-29

Best Hits

Swiss-Prot: 83% identical to FUMC_RALSO: Fumarate hydratase class II (fumC) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 97% identity to vap:Vapar_2522)

MetaCyc: 72% identical to fumarase C (Escherichia coli K-12 substr. MG1655)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>ABID97_RS17545 class II fumarate hydratase (Variovorax sp. OAS795)
MTTSPKTRAERDTFGPIDVLADKLWGAQTQRSLQNFDISGEQQPREIIKALAQVKRASAV
VNHALGLQDEKKTQAIVAAADEVIAGKHPGEFPLVVWQTGSGTQTNMNVNEVLANRASEL
LGGERGEGRLVHPNDDVNRSQSSNDVFPTAMHVAAVEAITHRLLPAIAKLRGTLDQKAKD
FAGIVKIGRTHLQDATPLTLGQEFSGYVAQLAHGEAHVRAALPHLCELALGGTAVGTGLN
APKGYAEQVAAELATLTGLPFVTAPSKFEAMASVDALVHAHGALKTLAASMNKIANDVRW
LASGPRSGIGELSIPENEPGSSIMPGKVNPTQSEAITMLAAQVFGNDVAINIGGASGNFE
LNVFRPMVAHNFLQSVRLLADGMVSFNDHCAVGIEPNRERITELVQRSLMLVTALNTHIG
YDKSAYIAKKAHKEGTSLREAAIASGHLTAEQFDQWVVPENMTGQ