Protein Info for ABID97_RS17515 in Variovorax sp. OAS795

Annotation: c-type cytochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00034: Cytochrom_C" amino acids 25 to 99 (75 residues), 36 bits, see alignment E=1.5e-12 PF13442: Cytochrome_CBB3" amino acids 27 to 97 (71 residues), 29.8 bits, see alignment E=6.3e-11

Best Hits

Swiss-Prot: 55% identical to CY552_NITEU: Cytochrome c-552 (cyt) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_2528)

Predicted SEED Role

"Cytochrome c551/c552" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>ABID97_RS17515 c-type cytochrome (Variovorax sp. OAS795)
MKRLLSFAVLGLGLAAPAFADLALATSKNCMSCHAVDRKVLGPAFKDVAAKYKGNAAAAD
MLATKIIKGGSGVWGPVPMPANTQVSEADAKKLAAWVLTR