Protein Info for ABID97_RS17460 in Variovorax sp. OAS795

Annotation: phenylacetaldoxime dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF13816: Dehydratase_hem" amino acids 44 to 346 (303 residues), 309.4 bits, see alignment E=3.1e-96

Best Hits

KEGG orthology group: K13028, aldoxime dehydratase [EC: 4.99.1.5] (inferred from 92% identity to vap:Vapar_2540)

MetaCyc: 55% identical to aldoxime dehydratase monomer (Pseudomonas chlororaphis B23)
4.2.1.-

Predicted SEED Role

"Aldoxime dehydratase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>ABID97_RS17460 phenylacetaldoxime dehydratase family protein (Variovorax sp. OAS795)
MESAIAEHLKCPRTRHRRVEDDYAPPYPVWSARAPAAVKQVVMGYFGVQSRGAAMQGRAC
EALMKIAAGFALPDGPGHHDFAHHVDADGFDNMIAIAYWDDPAAHACWCAAPGVDAWWRS
DERLSDGLGYFREIVSPRAERFETMFNTPDRLEGVGVVMGGVSGELQEHGYWGSMRDRIP
LSQTDAMAPSGVRAIVAGAPAPGQRVRVAGHENIAMIRSGQEWVDTTGQERTLYLEEMEP
VLREGMDFLRDQGLGIGCYSNRYMHHLDAKGSTLEKSFGLSFWRSLADMERWAESHPTHV
AIFGSFMRYVQALNFELQLRVYHEVSVLKADEQSYEYINCHARSGLVNGLGPA