Protein Info for ABID97_RS17440 in Variovorax sp. OAS795

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 29 to 55 (27 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details PF01925: TauE" amino acids 27 to 280 (254 residues), 187.5 bits, see alignment E=1.7e-59

Best Hits

KEGG orthology group: None (inferred from 98% identity to vap:Vapar_2544)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>ABID97_RS17440 sulfite exporter TauE/SafE family protein (Variovorax sp. OAS795)
MRCTGPLLFFKARCVNSLLDPLLIAELAALGLGTGFLAGLLGIGGGMLMVPFITIIMGHR
GVASDLAVKMAIATSMATIIFTSVSSVRAHHKRGAVRWDIVRRLAPGIVIGSLLGSLGVF
SLLKGTVLAIVFALFVGFSATQMFLDRKPKPTRQMPGTAGQLSAGGAIGFISGLVGAGGG
FVSVPFMTWCNISIHNAVATSAALGFPIAVANVLGYVISGQSVQGLPDGSFGYIWLPALV
VIAVCSVLTAPLGAKAAHNLPVKKLKRVFASILYLLAAYMLWKGLQG