Protein Info for ABID97_RS16725 in Variovorax sp. OAS795

Annotation: nicotinate (nicotinamide) nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 127 to 138 (12 residues), see Phobius details TIGR00125: cytidyltransferase-like domain" amino acids 10 to 68 (59 residues), 34.3 bits, see alignment E=2e-12 TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase" amino acids 12 to 206 (195 residues), 144.6 bits, see alignment E=3.8e-46 PF01467: CTP_transf_like" amino acids 12 to 181 (170 residues), 71.3 bits, see alignment E=4.7e-24

Best Hits

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 92% identity to vap:Vapar_2686)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>ABID97_RS16725 nicotinate (nicotinamide) nucleotide adenylyltransferase (Variovorax sp. OAS795)
MSASGPAPRIGIFGGAFDPPHNAHVALAEAALSQLGLAELHVIPTGQAWHKSRALTPAKD
RLAMARLAFSGLNGTVVVDSREVLRDGPTYTLDTLHELQREQPGAQLVLIMGADQASALP
TWHGWQAILGIAIVSVAYRALSAGGTARFDPKMLPGLPAGARFEALDLPAMDTSATDIRR
RAALGEDISSLVPPAVARYIDRHHLYRPA