Protein Info for ABID97_RS16400 in Variovorax sp. OAS795

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 6 to 204 (199 residues), 225.1 bits, E=4.6e-71
• PF00117: GATase
  • amino acids 7 to 199 (193 residues), 125.9 bits, E=4.1e-40
• PF07722: Peptidase_C26
  • amino acids 74 to 183 (110 residues), 32.1 bits, E=2.6e-11
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 214 to 549 (336 residues), 459.9 bits, E=4.4e-142
• PF02540: NAD_synthase
  • amino acids 219 to 254 (36 residues), 27.8 bits, 3.5e-10
• PF00958: GMP_synt_C
  • amino acids 462 to 548 (87 residues), 141.1 bits, E=2.4e-45

Best Hits

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 96% identity to vap:Vapar_2764)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (549 amino acids)

>ABID97_RS16400 glutamine-hydrolyzing GMP synthase (Variovorax sp. OAS795)
MQHDKILILDFGSQVTQLIARRVREAHVLSEVHPCDVTDEWVREYAADGHLKGVILSGSH
ASVYEETTDKAPQAVFDLGVPVLGICYGMQTMAHQLGGKVEGGHKREFGFASVRAHGHTA
LLKDIADFTTPEGHGMLNVWMSHGDKVTELPPGFKLMASTESCPIAGMADEARRYYALQF
HPEVTHTVQGKAIIERFVLGICESKPDWVMRDHIAEAVAKIREQVGDEEVILGLSGGVDS
SVAAALIHRAIGDQLTCVFVDHGLLRLDEGDMVMEMFEGKLHAKVIRVDASDLFLGKLAG
VSEPEAKRKIIGGEFVTVFKQEAAKLKAAGDGGKNGVDGRPSVKGATFLAQGTIYPDVIE
SGGAKSKKAVTIKSHHNVGGLPEQLGLKLLEPLRDLFKDEVRELGVALGLPPEMVYRHPF
PGPGLGVRILGEVKKEYADLLRRADAIFIEELRNFKDDATGKSWYDLTSQAFTVFLPVKS
VGVMGDGRTYDYVVALRAVQTSDFMTADWAELPYALLKKVSGRIINEVRGINRVTYDVSS
KPPATIEWE