Protein Info for ABID97_RS15905 in Variovorax sp. OAS795

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 116 to 142 (27 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details amino acids 443 to 464 (22 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 42 to 443 (402 residues), 245.3 bits, see alignment E=5.1e-77 PF01554: MatE" amino acids 42 to 201 (160 residues), 107.6 bits, see alignment E=2.8e-35 amino acids 271 to 431 (161 residues), 93.8 bits, see alignment E=4.7e-31

Best Hits

Swiss-Prot: 46% identical to YOEA_BACSU: Probable multidrug resistance protein YoeA (yoeA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_2889)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>ABID97_RS15905 MATE family efflux transporter (Variovorax sp. OAS795)
MRATSETAATGQPAQATLRGTPAAPVGAQRALWKTFLFFLAPMLLSNILQSLSGTINNIY
IGQMIGVGALAAVSSFFPVMFFFIAFVIGLGAGASVLIGQAWGARDVGKAKAIAGTTLSV
GMLLGLAVAVFGGAFTTPLLAFLGTPPDVLADSTRYARIMLIAMPGLFVFLLSTAMLRGV
GDTVTPLLTLIFSTAAGLIVTPALIRGWGGLPQLGVASGAWATVVGFVASTLWLGWRLRR
RGSPLAPDAELFRHLRIDPKLLKAVLKVGVPTGVQMIVVALSEVALLSLVNSYGSSATAA
YGAVNQVVAYVQFPAISIAITASILGAQAIGAGRADRLGAIAKTALLMNLALTGGLVLLG
YLFSRHLMGFFITSAPVIEVAQSLLHIMLWSLVIFGMASALSGIMRASGSVLVPTAISIL
CLIGIEVPVAWFMSHRIGLDGIWYAYPVTFGAMLLLQTAYYRLVWRKKAIRRMV