Protein Info for ABID97_RS15870 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 256 to 281 (26 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details amino acids 350 to 367 (18 residues), see Phobius details amino acids 389 to 411 (23 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details PF07690: MFS_1" amino acids 5 to 399 (395 residues), 161.8 bits, see alignment E=1.1e-51

Best Hits

KEGG orthology group: K08169, MFS transporter, DHA2 family, multidrug resistance protein (inferred from 94% identity to vap:Vapar_2896)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>ABID97_RS15870 MFS transporter (Variovorax sp. OAS795)
MLVIILGIMVAVLDGTIVNLALPGIARELQASPSHAIWVVNAYQIATLVMLLPLASLGDL
VGYRRVYLVGMAVFTVSSLGATFADSLGTLIVARTFQGLGAAGIMSVNAALVRLTFPSAL
LGRGMAINSMVVATSSVAGPSVAAAILSVASWPWLFAINVPLGLLVFVLGMKALPFNRVA
PAAGLRFSPLDVALNVLMFSLVFLGVDRLGVREGGAPSPMAWAILLAGVAVGVVYIRRQR
SLAVPLFPIDLLRIPVFALSMGTSVAAFCAQMLAYIALPFLLLEVYGRSHIEAGLLITAW
PLAIVAMAPVAGRLIGRYPDGLLGGIGLGLLALGLGLLAALPAQPGNADIAWRMALCGLG
FGLFQSPNNHTIVTSPPAHRSGAASGMLGTARLTGQTLGAVVLAGVFSIWTPHGGRGPVV
ALVLAACCAGVAAVFSSLRLKTTGPHG