Protein Info for ABID97_RS15745 in Variovorax sp. OAS795

Annotation: M20 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04389: Peptidase_M28" amino acids 104 to 204 (101 residues), 25.9 bits, see alignment E=1.1e-09 PF01546: Peptidase_M20" amino acids 116 to 483 (368 residues), 101 bits, see alignment E=1.4e-32 PF07687: M20_dimer" amino acids 239 to 382 (144 residues), 48.7 bits, see alignment E=9.5e-17

Best Hits

Swiss-Prot: 44% identical to P2012_DANRE: N-fatty-acyl-amino acid synthase/hydrolase PM20D1.2 (pm20d1.2) from Danio rerio

KEGG orthology group: K13049, carboxypeptidase PM20D1 [EC: 3.4.17.-] (inferred from 94% identity to vap:Vapar_2924)

Predicted SEED Role

"macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.17.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>ABID97_RS15745 M20 family peptidase (Variovorax sp. OAS795)
MLKRIFLGLLLVLVALVAAVAVKTWRTPSQQLAVAPAPKLEIDVQAAAKRLAGAIPIRTV
SSLDDPAASLAEFDKLHAYLAQQFPQLHATLKKEVVGQRALLYTWAGTDPQAKPIALMAH
QDMVPIAPGTEKAWSVDPFAGEIKDGFVWGRGTLDNKSNLFAQMEAVELLVASGFKPRQT
VYLVMGDDEEVSGLRGARPIAELLKSRNVRLDWVLDEGLLILDGVLPGLSKPAALIGLAE
KGYGTFFLSLDTAPGHSSMPPQHSAIGSMSAALARLEATPMPGGIRGVAAQMFGALAPEM
GGVNRVMLSNLWLTEPLVRGQLEKSPSSNAMLRTTTALTIVRAGNKDNVLPGRAEAAVNF
RILPGDSIDSVEAHLRKALGNDEIKIKRYPGNSEPSPVSPTDSTGYRAIQQAVRQSFPDV
IVAPGLMTAATDSRHFSLVSDAVYRFSPFRMKGEDLARFHGTNERLAISNYGEMIGFYHQ
LLRNTNGAPAQ