Protein Info for ABID97_RS15335 in Variovorax sp. OAS795

Annotation: cytosine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 328 to 345 (18 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details amino acids 384 to 401 (18 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 16 to 367 (352 residues), 40.2 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_2400)

Predicted SEED Role

"Predicted hydroxymethylpyrimidine transporter CytX" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>ABID97_RS15335 cytosine permease (Variovorax sp. OAS795)
MAHDDDFSSANEALTPLPASRRVFGWNDHASLWFSLGVGLLVMQIGAYLVPAVGTRDAAI
AIVLGSLLGAGLLAWTARLGCESGLASAGLMHATYGSAFARLPVLLNIVQLVGWTTFELV
IMREGTQAIGQQAFGLTLTGPLGGALTTLLWGAVLLALLAGSMVKLVRRFVSRFGLPLVV
LSLLWLTWQFATRLQAKGLDDFWARPGDGGMGIFGALDLVIAMPVSWLPLVADYARHGKR
SAGGLGSAFSGTWIGYALANVWCYALGVMVVSVAEPGTGLVTALLLAQGGLVALGLILID
ELDNAYGDVYSGSVSTHSLLPRWSVRQWGLLLAALCTALALVLPMHTLEPFLLMLSSVFV
PLYGVILGRLGTGQSMASLGTRRVDLGAALIWIGGIAAYHACARWAPQFGSALPTLAATF
VLAWISRPRPTSTTAGDASALAQSRG