Protein Info for ABID97_RS15260 in Variovorax sp. OAS795

Annotation: phage portal protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 87 to 104 (18 residues), see Phobius details TIGR01540: phage portal protein, PBSX family" amino acids 43 to 321 (279 residues), 255.6 bits, see alignment E=3.4e-80 PF04860: Phage_portal" amino acids 92 to 311 (220 residues), 44.5 bits, see alignment E=5.9e-16

Best Hits

Swiss-Prot: 58% identical to PORTL_BPP2: Probable portal protein (Q) from Escherichia phage P2

KEGG orthology group: None (inferred from 85% identity to pna:Pnap_3288)

Predicted SEED Role

"Phage-related capsid packaging protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>ABID97_RS15260 phage portal protein (Variovorax sp. OAS795)
MDTTTTPANNPARMEAFSFGDPTPVMDRRELLDYIECWMNGRWYEPPISLEGLARSFRAS
THHSSSIYFKRNILLSTFVPHKLFDRATFSAYALDFLIFGNAYLERRDSMTRRAVGLKHA
LAKYMRRGADLDTYFFVRGWKDEHEFKAGSVFHMREADINQEVYGLPEYLSALQSAWLNE
SATLFRRRYYNNGSHAGFILYISDPAQQQDDIDAMRTALKESKGPGNFRNLFLYSPNGKK
DGVQLIPVSEVAAKDEFFNIKNVSRDDVLAAHRVPPQLMGIVPSNTGGFGAVLPAAQVFA
RNEIKPLQDRFREINEWMGEEVVRFTDYEVPTGEAAAAP