Protein Info for ABID97_RS14915 in Variovorax sp. OAS795

Annotation: serine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF00768: Peptidase_S11" amino acids 129 to 351 (223 residues), 195.3 bits, see alignment E=1.2e-61 PF13354: Beta-lactamase2" amino acids 137 to 282 (146 residues), 42.3 bits, see alignment E=5.1e-15

Best Hits

KEGG orthology group: K07262, D-alanyl-D-alanine endopeptidase (penicillin-binding protein 7) [EC: 3.4.21.-] (inferred from 93% identity to vap:Vapar_2375)

Predicted SEED Role

"D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.16.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4, 3.4.21.-

Use Curated BLAST to search for 3.4.16.4 or 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>ABID97_RS14915 serine hydrolase (Variovorax sp. OAS795)
MPEARLRRVSSQRFLPAVKFVAVALCATAFLLSGAQAAKKEKTSTAKTSLAKKAAGPVPV
EVKRNTKSSRSVDRGEKVVRGGRNVVASIRQKNGRTVVAVQRRSVVRVETPARQSFGQLA
GLHGTDDVLELKSSVALVIDQDTHEVLFSKNDHAVLPIASLTKLMTGLLISEARLPNDEL
ITITQDDVDTEKGSRSRLTVGTTLPRGELLHLALMSSENRAAHALGRTYPGGLATFVSIM
NAKAKMLGMKDTRYVEPTGLSSRNQSSAQDLALLVNAAYSDATVRSLSTSPEYQVEVGNR
VLQFNTTNRLVKSPDWEIGVQKTGYISEAGQCLVMQAKVAGRKLIMVFLDSAGKFSRIAD
AERVRRWVEATHASGSPAAASRAASLQVAG